PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G0094
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 281aa    MW: 32127.7 Da    PI: 6.6822
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G0094genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++v ++G g+W+++a   g+ R +k+c++rw +yl
      Gh_D11G0094 16 KGLWSPEEDLKLRNYVLKHGHGCWTSVAINAGLQRNGKSCRLRWINYL 63
                     678*******************************************97 PP

2Myb_DNA-binding49.87.7e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++++E++ ++ ++++lG++ W+ Ia+ ++ gRt++++k++w+++l
      Gh_D11G0094  69 RGMFSPQEEDTILTLHHLLGNR-WSQIAQNLP-GRTDNEIKNYWHSHL 114
                      788*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.1321167IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-221266IPR009057Homeodomain-like
SuperFamilySSF466894.4E-2914110IPR009057Homeodomain-like
SMARTSM007173.5E-121565IPR001005SANT/Myb domain
PfamPF002495.9E-151663IPR001005SANT/Myb domain
CDDcd001671.00E-101963No hitNo description
Gene3DG3DSA:1.10.10.602.3E-2567118IPR009057Homeodomain-like
SMARTSM007171.8E-1468116IPR001005SANT/Myb domain
PROSITE profilePS5129419.91568118IPR017930Myb domain
PfamPF002494.9E-1569114IPR001005SANT/Myb domain
CDDcd001674.42E-1172114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGSKSSDQKP RAKHRKGLWS PEEDLKLRNY VLKHGHGCWT SVAINAGLQR NGKSCRLRWI  60
NYLRPGLKRG MFSPQEEDTI LTLHHLLGNR WSQIAQNLPG RTDNEIKNYW HSHLKKRVAK  120
AEELEPQTRT PYTTSSSENT DSALSPRNFA DMRIPSFEPF HHIEKPSIST DQTVARQLNF  180
SNEPHGSLMP RLLFAEWLSI DQEGESVTNS ASLNGFNRGS SSNFQDPFLS AYLGSFDNDF  240
QDGLSYALVN DEMFSSEFKF ETQISEEEFL GNEINNNVLY I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-24161187108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488169.10.0PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K41e-61LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A0D2S4Y60.0A0A0D2S4Y6_G
STRINGPOPTR_0015s13190.19e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.18e-63myb domain protein 18